Arc (proteína)
Arc es un gen que codifica para una proteína asociada al citoesqueleto regulada por actividad (Activity-Regulated Cytoskeleton-associated protein). También conocido como Arg3.1, Arc forma parte de la familia de genes de expresión inmediata-temprana.

Esto es un extracto del artículo Arc (proteína) de la enciclopedia libre Wikipedia. En Wikipedia hay disponible una lista de los autores.
En los últimos 30 días se ha accedido 103 veces al artículo Arc (proteína) en es.wikipedia.org. (Versión: 28.12.2013)
Imágenes de Arc (proteína)
Vista previa:
Original:
Resultados de la búsqueda de Google y Bing
1
>30
1
Arc (proteína) - Wikipedia, la enciclopedia libre
Arc es un gen que codifica para una proteína asociada al citoesqueleto regulada por actividad (Activity-Regulated Cytoskeleton-associated protein). También ...
es.wikipedia.org/wiki/Arc_(prote%C3%ADna)
2
>30
2
Arc, la proteína de la buena memoria - Muy Interesante
11 Jun 2013 ... Científicos de los Institutos Gladstone de California (Estados Unidos) han descifrado cómo una proteína llamada Arc interviene...
www.muyinteresante.es/salud/articulo/arc-la-proteina-de-la-buena-memoria-841370936594
3
>30
3
Arc: Una importante proteína llamada "Arc" ayuda a traducir ...
12 Jun 2013 ... Científicos de los Institutos Gladstone, en San Francisco, California (Estados Unidos), han descifrado cómo una proteína llamada Arc regula la ...
www.galenored.net/una-importante-proteina-llamada-arc-ayuda-a-traducir-el-aprendizaje-en-recuerdos/
4
>30
4
Encuentran clave de la buena memoria en una proteína :: El ...
11 Jun 2013 ... “Los científicos sabían que Arc estaba involucrada en la memoria a largo plazo, ya que los ratones que carecen de la proteína Arc pueden ...
www.informador.com.mx/tecnologia/2013/464175/6/encuentran-clave-de-la-buena-memoria-en-una-proteina.htm
5
>30
5
Arc, la proteína de la buena memoria - Frontera
11 Jun 2013 ... MÉXICO, D. F.(Agencias) Científicos de los Institutos Gladstone de California ( Estados Unidos) han descifrado cómo una proteína llamada Arc ...
www.frontera.info/EdicionEnLinea/Notas/CienciayTecnologia/11062013/714236-Arc-la-proteina-de-la-buena-memoria.html
6
>30
6
Una importante proteína ayuda a traducir el aprendizaje en recuerdos
10 Jun 2013 ... Científicos de los Institutos Gladstone, en San Francisco, California (Estados Unidos), han descifrado cómo una proteína llamada Arc regula la ...
www.europapress.es/salud/noticia-importante-proteina-ayuda-traducir-aprendizaje-recuerdos-20130610092221.html
7
>30
7
SU MEDICO: Hallan proteína que regula las neuronas-
11 Jun 2013 ... Identifican una proteína, llamada Arc que ayuda a regular la actividad de las neuronas, con lo que se podría tener la clave para analizar la ...
www.sumedico.com/nota15578.html
8
>30
8
ARC, proteína de la buena memoria - CIENCIAS del MUNDO ...
14 Jun 2013 ... Han descifrado que esta proteína se encuentra en el cerebro e interviene en la formación de recuerdos duraderos. Se demostró con un ratón ...
cmcescolapiosbio.blogspot.com/2013/06/arc-proteina-de-la-buena-memoria.html
9
>30
9
Funcionamiento del cerebro - Solociencia.com
La proteína, llamada "Arc", fue detectada previamente en el hipocampo, donde se cree que ayuda a almacenar recuerdos duraderos al fortalecer las sinapsis, ...
www.solociencia.com/medicina/06090606.htm
10
>30
10
Arc Anticuerpo(H-300) | Santa Cruz Biotech
Secuencia completa de la proteína para Arc con inmunógeno inidcado: MELDHRTSGGLHAYPGPRGGQVAKPNVILQ See more.
www.scbt.com/es/datasheet-15325-arc-h-300-antibody.html
Resultados de la búsqueda para "Arc (proteína)"
Google: aprox. 256.000
bing: aprox. 500
Arc (proteína) en el ámbito científico
Arc, la proteína de la buena memoria - Muy Interesante
11 Jun 2013 ... Arc, la proteína de la buena memoria ... el investigador Steve Finkbeiner, profesor de Neurología y Fisiología en la Universidad de California, ...
En una proteína se encuentra la clave para la buena memoria en ...
11 Jun 2013 ... “Los científicos sabían que Arc estaba involucrada en la memoria a ... y Fisiología en la Universidad de California, San Francisco (UCSF). ... Ver los canales de Televisa y TV Azteca destruyen la proteína arc y todo el cerebro.
Arc: Una importante proteína llamada "Arc" ayuda a traducir ...
12 Jun 2013... han descifrado cómo una proteína llamada Arc regula la actividad de ... profesor de Neurología y Fisiología en la Universidad de California, ...
Una importante proteína ayuda a traducir el aprendizaje en recuerdos
10 Jun 2013 ... Científicos de los Institutos Gladstone, en San Francisco, California (Estados Unidos), han descifrado cómo una proteína llamada Arc...
Arc, la proteína de la buena memoria - Frontera
11 Jun 2013 ... Arc, la proteína de la buena memoria. ... el investigador Steve Finkbeiner, profesor de Neurología y Fisiología en la Universidad de California, ...
Encuentran clave de la buena memoria en una proteína :: El ...
11 Jun 2013 ... La proteína Arc, que se encuentra en el cerebro, resulta fundamental en ... y Fisiología en la Universidad de California, San Francisco (UCSF).
Proteína Arc 'podría ser la clave para la pérdida de memoria ", dice ...
Ceril Las Condes wrote a note titled Proteína Arc 'podría ser la clave para la ... Dr . Steve Finkbeiner, profesor de neurología y fisiología en la Universidad de ...
Arc (proteína) - Wikipedia, la enciclopedia libre
Arc es un gen que codifica para una proteína asociada al citoesqueleto regulada por actividad (Activity-Regulated Cytoskeleton-associated protein). También ...
Libros sobre el término Arc (proteína)
Cuarto simposio latinoamericano sobre caficultura
Cuarto simposio latinoamericano sobre caficultura
1981
Para el caso de la proteína superficial, hay diversos autores que la consideran como mínima o igual a cero (Burroughs 1971, 1974, 1975a, 1975b; Van Soest 1982). El NRC (1978) la estima equivalente a 0.2W0Í. Por su parte, el ARC (1980 ) ...
Nou Arç. Llengua catalana i literatura 1r ESO
Nou Arç. Llengua catalana i literatura 1r ESO
Joan Badia Pujol, Jordi Balcells Domènech, Isabel Casanellas Bassols y Jordi Grifoll Àvila, 2008
Catalán (Lengua y Literatura).Catalán. Del alumno.Educación Secundaria Obligatoria.Primero
Efecto De La Suplementacion Energetica En Vacas Frisonas Bajo ...
Efecto De La Suplementacion Energetica En Vacas Frisonas Bajo ...
Diego Proano Egas
En cuanto a necesidades nitrogenadas, el ARC las expresa en términos de "proteína degradable en el rumen" (RDP) y "proteína no degradable" (UDP), cuya suma da la proteína bruta total. Se han desarrollado cálculos teóricos de las ...
Diccionario de ciencias hortícolas
Diccionario de ciencias hortícolas
Sociedad Española de Ciencias Hortícolas, 1999
La unión anticuerpo-proteína, que se pone de manifiesto por métodos radiactivos o enzimáticos. proporciona información cualitativa y cuantitativa de la proteína. transformación angular (angular transforma- tion, arc sin transformation ).
L'Abbaye de la Vallée D'Arc
L'Abbaye de la Vallée D'Arc
François Puaux, 2008
This is a pre-1923 historical reproduction that was curated for quality. Quality assurance was conducted on each of these books in an attempt to remove books with imperfections introduced by the digitization process. Though we have made best efforts - the books may have occasional errors that do not impede the reading experience. We believe this wo...
Texto de Bioquimica para Estudiantes de Medicina / Text of ...
Texto de Bioquimica para Estudiantes de Medicina / Text of ...
D. M. Vasudevan, S. Sreekumari, 2012
27-OHC es capaz de suprimir la expresión de la proteína asociada al citoesqueleto (Arc), una proteína importante enla consolidación dela memoria la cual se encuentra reducida en pacientes con AD.
Biologia y agronomía de especies forrajeras de Arachis
Biologia y agronomía de especies forrajeras de Arachis
Peter C. Kerridge, 1995
Proteína cruda (PC) y digestibilidad in vitro de materia seca (DIVMS) o digestibilidad in vitro de materia orgánica (DIVMO) de especies ... Arb 9-11 — 58 -62 Heno cosechado en cinco épocas de cultivo, Jay, ARC, Florida Prine etal., 1981 cv.
Proteinas vegetales
Proteinas vegetales
NURIA VIVER BARRI, 2012
Las proteínas son elementos imprescindibles para la vida. Participan en la defensa contra las infecciones, en la digestión de los alimentos, en la formación de huesos y músculos y en el correcto estado de funciones como la visión o la locomoción. Contrariamente a lo que mucha gente cree, las proteínas no solo proceden de los alimentos de origen ani...
Progreso de las búsquedas en Google


Entradas de blog sobre el término
Arc (proteína)
Arc, la proteína de la buena memoria « Cañasanta
www.canasanta.com/2013/06/12/arc-la-proteina-de-la-buena-memoria/
Una proteína llamada Arc ayuda a traducir el aprendizaje en recuerdos | canariasactual.com
Una proteína llamada Arc ayuda a traducir el aprendizaje en recuerdos Salud Canarias, on junio 10, 2013 0.
canariasactual.com/2013/06/10/una-importante-proteina-ayuda-a-traducir-el-aprendizaje-en-recuerdos/
CIENCIAS del MUNDO CONTEMPORÁNEO 1º B ESCOLAPIOS: ARC, proteína de la buena memoria
The protein of good memory has been found. Scientists have made sure that this protein can keep lasting memories.
cmcescolapiosbio.blogspot.com/2013/06/arc-proteina-de-la-buena-memoria.html
Encuentran clave de la buena memoria en una proteína :: El Informador
La proteína Arc, que se encuentra en el cerebro, resulta fundamental en la traducción de aprendizaje en recuerdos a largo plazo
www.informador.com.mx/tecnologia/2013/464175/6/encuentran-clave-de-la-buena-memoria-en-una-proteina.htm
Descubren proteína que faculta la creación de recuerdos duraderos - El blog de Marcela Toso
DESCUBREN PROTEINA QUE FACULTA LA CREACIÓNDE RECUERDOS DURADEROSAcaban de hallar que una proteína, denominada Arc, proporciona unafundamental capacidad al cerebro para regular la actividad de las ne… Alojado por OverBlog
tosomarcelainfosalud-sofia.over-blog.es/article-descubren-proteina-que-faculta-la-creacion-de-recuerdos-duraderos-118651403.html
Coffee Break: Arc, la proteína de la buena memoria
Científicos de los Institutos Gladstone de California (Estados Unidos) han descifrado cómo una proteína llamada Arc interviene en la formación de recuerdos duraderos. el hallazgo se publica en la revista Nature Neuroscience.
coffeebreakes.blogspot.com/2013/06/arc-la-proteina-de-la-buena-memoria.html
Arc, la proteina della memoria | Scienze Naturali
Secondo uno studio condotto da un'equipe di ricercatori americani dell'Università della California, la perdita della memoria a lungo termine e le malattie ad essa connesse, tra cui l'Alzheimer e l'autismo, sembrano essere associata alla carenza della proteina Arc (Activity-regulated cytoskeletal).
www.scienze-naturali.it/medicina-salute/arc-la-proteina-della-memoria
Proteina Arc mund të jetë çelësi për humbjen e kujtesës | Vizion Plus TV
vizionplus.al/proteina-arc-mund-te-jete-celesi-per-humbjen-e-kujteses/
Arc, la proteína de la buena memoria - La Isla Buscada Noticias
Blog que recoge las últimas entradas de distintas webs populares
laislabuscada.es/arc-la-protena-de-la-buena-memoria/
Proteínas que favorecen los recuerdos
Interesante artículo que muestra cómo la proteína Arc puede ser la que permita a las neuronas fortalecer nuevas conexiones sinápticas que posteriormente originarán los recuerdos. Científicos de los Institutos Gladstone, en San Francisco, California (Estados Unidos), han descifrado cómo una proteína llamada Arc regula la actividad de las neuronas, lo que proporciona pistas muy necesarias en la capacidad del cerebro para formar recuerdos duraderos.
www.mamilogopeda.com/2013/06/proteinas-que-favorecen-los-recuerdos.html
123